• Featured Product
  • KD/KO Validated

Cardinal Red™-conjugated Histone H3 Polyclonal antibody

Histone H3 Polyclonal Antibody for FC (Intra)

Cat No. CR-17168

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

HIST2H3A, H3-clustered histone 15, H3-clustered histone 14, H3-clustered histone 13, H3C15

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CR-17168 targets Histone H3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10644

Product name: Recombinant human Histone-H3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-136 aa of BC015544

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predict reactive species
Full Name histone cluster 2, H3a
Calculated Molecular Weight 136 aa, 15 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC015544
Gene Symbol Histone H3
Gene ID (NCBI) 333932
RRIDAB_2934337
Conjugate Cardinal Red™ Fluorescent Dye
Excitation/Emission Maxima Wavelengths592 nm / 611 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ71DI3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.

Protocols

Product Specific Protocols
FC protocol for Cardinal Red™ Histone H3 antibody CR-17168Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...