Tested Applications
Positive FC (Intra) detected in | PMA, Ionomycin and Brefeldin A treated human PBMCs |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension |
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-98159 targets IL-13 in FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0061 Product name: Recombinant Human IL-13 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 21-132 aa of AAK53823 Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN Predict reactive species |
Full Name | interleukin 13 |
GenBank Accession Number | AAK53823 |
Gene Symbol | IL-13 |
Gene ID (NCBI) | 3596 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P35225 |
Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL594 IL-13 antibody CL594-98159 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |