Mouse IL-16 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of RAW 264.7 using 86421-1-RR (same clone as 86421-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 86421-1-RR (Il16 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86421-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86421-1-RR (same clone as 86421-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86421-1-RR (Il16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 86421-1-RR (same clone as 86421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 86421-1-RR (IL-16 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86421-1-PBS in a different storage buffer formulation.

IL-16 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86421-1-PBS

Clone No.250058G12

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Il16, Interleukin-16, Pro-interleukin-16

---

Product Information

86421-1-PBS targets IL-16 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3127

  Product name: Recombinant Mouse IL-16 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1205-1322 aa of NM_010551.3

  Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

• Full Name: interleukin 16
• Calculated Molecular Weight: 141 kDa
• Observed Molecular Weight: 66-72 kDa
• GenBank Accession Number: NM_010551.3
• Gene Symbol: Il16
• Gene ID (NCBI): 16170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54824-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Pro-IL-16 can be detected at about 80 kDa, and cleaved fragments can be deteced at between 40 and 75 kDa.