Mouse IL-16 Recombinant monoclonal antibody, PBS Only

IL-16 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 86421-1-PBS
Clone No.250058G12

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Il16, Interleukin-16, Pro-interleukin-16

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86421-1-PBS targets IL-16 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3127

Product name: Recombinant Mouse IL-16 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 1205-1322 aa of NM_010551.3

Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Predict reactive species
Full Name interleukin 16
Calculated Molecular Weight141 kDa
Observed Molecular Weight66-72 kDa
GenBank Accession NumberNM_010551.3
Gene Symbol Il16
Gene ID (NCBI) 16170
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO54824-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Pro-IL-16 can be detected at about 80 kDa, and cleaved fragments can be deteced at between 40 and 75 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...