Use Able AI chat for product recommendations

IL-16 Recombinant monoclonal antibody

IL-16 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86421-1-RR
Clone No.250058G12

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Il16, Interleukin-16, Pro-interleukin-16

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells, mouse spleen tissue, mouse thymus tissue, rat thymus tissue
Positive IHC detected inmouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86421-1-RR targets IL-16 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3127

Product name: Recombinant Mouse IL-16 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 1205-1322 aa of NM_010551.3

Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Predict reactive species
Full Name interleukin 16
Calculated Molecular Weight141 kDa
Observed Molecular Weight66-72 kDa
GenBank Accession NumberNM_010551.3
Gene Symbol Il16
Gene ID (NCBI) 16170
RRIDAB_3744868
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO54824-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Pro-IL-16 can be detected at about 80 kDa, and cleaved fragments can be deteced at between 40 and 75 kDa.

Protocols

Product Specific Protocols
IHC protocol for IL-16 antibody 86421-1-RRDownload protocol
WB protocol for IL-16 antibody 86421-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...