Tested Applications
Positive FC (Intra) detected in | PMA and ionomycin treated C57BL/6 Th17-polarized splenocytes |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension |
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
PE-98005 targets IL-17A in FC (Intra) applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0624 Product name: Recombinant mouse IL-17A protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species |
Full Name | interleukin 17A |
Calculated Molecular Weight | 17 kDa |
GenBank Accession Number | NM-010552 |
Gene Symbol | Il17a |
Gene ID (NCBI) | 16171 |
Conjugate | PE Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 496 nm, 565 nm / 578 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q62386 |
Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
IL-17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for PE IL-17A antibody PE-98005 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |