IL-7 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-7 Recombinant monoclonal antibody (87917-1-RR)

IL-7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87917-1-RR

Clone No.260172C5

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, ELISA

Synonyms

IL7, Interleukin-7

• 

  WB analysis using 87917-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87917-1-RR (IL-7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87917-1-RR targets IL-7 in WB, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6241

  Product name: Recombinant rat IL7 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-154 aa of /

  Sequence: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI

• Full Name: interleukin 7
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: /
• Gene Symbol: Il7
• Gene ID (NCBI): 25647
• RRID: AB_3745825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-7 (IL-7) is a cytokine involved in B and T cell development. It plays an active role in the development, survival, maintaining and restoring homeostasis of mature T lymphocytes and is a key regulator of the commitment, survival, proliferation and maturation of B cells during development. Furthermore, IL-7 can improve the antiviral function and expansion of natural killer (NK) cells and regulate the development and differentiation of dendritic cells. IL-7 has also been reported as a regulator of the development of central nervous system and myogenesis and skeletal muscle cell migration. (PMID: 29663382; 29655570; 29449560)