CoraLite®594-conjugated IL-9 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL594-66144

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite®594 IL-9 antibody (CL594-66144, Clone: 1F3A11 ) at dilution of 1:200.

IL-9 Monoclonal Antibody for IF-P

Cat No. CL594-66144

Clone No.1F3A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF-P

Synonyms

Cytokine P40, HP40, IL 9, IL9, interleukin 9, P40, T cell growth factor P40

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66144 targets IL-9 in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21435

  Product name: Recombinant human IL-9 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 31-144 aa of BC066284

  Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

• Full Name: interleukin 9
• Calculated Molecular Weight: 144 aa, 16 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC066284
• Gene Symbol: IL9
• Gene ID (NCBI): 3578
• RRID: AB_2919954
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15248
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.