Tested Applications
| Positive WB detected in | COLO 320 cells, HepG2 cells, HEK-293 cells, HeLa cells, Raji cells, mouse brain tissue, MCF-7 cells, rat brain tissue |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 12 publications below |
| WB | See 99 publications below |
| IHC | See 2 publications below |
| IF | See 18 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
10179-1-AP targets IMMT in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0102 Product name: Recombinant human IMMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-297 aa of BC002412 Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK Predict reactive species |
| Full Name | inner membrane protein, mitochondrial (mitofilin) |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 80-90 kDa |
| GenBank Accession Number | BC002412 |
| Gene Symbol | IMMT |
| Gene ID (NCBI) | 10989 |
| RRID | AB_2127193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16891 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IMMT antibody 10179-1-AP | Download protocol |
| IF protocol for IMMT antibody 10179-1-AP | Download protocol |
| IHC protocol for IMMT antibody 10179-1-AP | Download protocol |
| IP protocol for IMMT antibody 10179-1-AP | Download protocol |
| WB protocol for IMMT antibody 10179-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Liver mitochondrial cristae organizing protein MIC19 promotes energy expenditure and pedestrian locomotion by altering nucleotide metabolism | ||
Cell Metab A cold-stress-inducible PERK/OGT axis controls TOM70-assisted mitochondrial protein import and cristae formation. | ||
Cell Metab The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. | ||
Mol Cell Mitochondrial DNA breaks activate an integrated stress response to reestablish homeostasis | ||
Mol Cell The interplay between BAX and BAK tunes apoptotic pore growth to control mitochondrial-DNA-mediated inflammation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mia (Verified Customer) (09-28-2022) | very clear band
|
FH siiting (Verified Customer) (03-20-2022) | very good antibody, second time buy already
|
FH Maria (Verified Customer) (08-15-2021) | Mitofilin in human primary fibroblasts. Blocking with 5% milk in PBST (0.1%t tween) 1h RT. Primary ab 1:1000 in BSA 3% in PBST O/N at 4º incubation. Secondary 1:5000 HRP 1h RT.
![]() |
FH CYNTHIA (Verified Customer) (07-16-2020) | I used the mitofilin on my WB samples at the beginning it was great but in 3 times of using it i couldn't understand why it doesn't work. but i recommend ure antibodies to my colleagues
|
FH SITING (Verified Customer) (07-13-2020) | SHOW VERY STRONG SIGNAL
|
FH Yan (Verified Customer) (01-28-2020) | This antibody worked very well on mouse heart tissue for western blot.
|




















