• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IMMT Polyclonal antibody

IMMT Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10179

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Mitofilin, MINOS2, MICOS complex subunit MIC60, MIC60, HMP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10179 targets IMMT in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0102

Product name: Recombinant human IMMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-297 aa of BC002412

Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK

Predict reactive species
Full Name inner membrane protein, mitochondrial (mitofilin)
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 80-90 kDa
GenBank Accession NumberBC002412
Gene Symbol IMMT
Gene ID (NCBI) 10989
RRIDAB_2918958
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16891
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IMMT antibody CL488-10179Download protocol
FC protocol for CL Plus 488 IMMT antibody CL488-10179Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...