CoraLite® Plus 488-conjugated IMUP Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-84148-6

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 IMUP antibody (CL488-84148-6, Clone: 241220B4 ) at dilution of 1:200.

IMUP Recombinant Antibody for IF/ICC

Cat No. CL488-84148-6

Clone No.241220B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

Immortalization up-regulated protein, Hepatocyte growth factor activator inhibitor type 2-related small protein, HAI-2-related small protein, H2RSP, C19orf33

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84148-6 targets IMUP in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22218

  Product name: Recombinant human C19orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC060319

  Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

• Full Name: chromosome 19 open reading frame 33
• Calculated Molecular Weight: 106 aa, 11 kDa
• GenBank Accession Number: BC060319
• Gene Symbol: IMUP
• Gene ID (NCBI): 64073
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9GZP8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599).