CoraLite® Plus 488-conjugated IMUP Recombinant monoclonal antibody

IMUP Recombinant Antibody for IF/ICC
Cat No. CL488-84148-6
Clone No.241220B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Immortalization up-regulated protein, Hepatocyte growth factor activator inhibitor type 2-related small protein, HAI-2-related small protein, H2RSP, C19orf33

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84148-6 targets IMUP in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22218

Product name: Recombinant human C19orf33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-85 aa of BC060319

Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Predict reactive species
Full Name chromosome 19 open reading frame 33
Calculated Molecular Weight 106 aa, 11 kDa
GenBank Accession NumberBC060319
Gene Symbol IMUP
Gene ID (NCBI) 64073
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9GZP8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IMUP antibody CL488-84148-6Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...