IMUP Recombinant monoclonal antibody

• 

  IHC staining of human skin cancer using 84148-6-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84148-6-RR (IMUP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 84148-6-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84148-6-RR (IMUP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 84148-6-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using C19orf33 antibody (84148-6-RR, Clone: 241220B4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84148-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84148-6-RR against Human IMUP were performed. The affinity constant is 10.3 nM.

IMUP Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 84148-6-RR

Clone No.241220B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

Immortalization up-regulated protein, Hepatocyte growth factor activator inhibitor type 2-related small protein, HAI-2-related small protein, H2RSP, C19orf33

---

Tested Applications

• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84148-6-RR targets IMUP in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22218

  Product name: Recombinant human C19orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC060319

  Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

• Full Name: chromosome 19 open reading frame 33
• Calculated Molecular Weight: 106 aa, 11 kDa
• GenBank Accession Number: BC060319
• Gene Symbol: IMUP
• Gene ID (NCBI): 64073
• RRID: AB_3671711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9GZP8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599).