Product Information
CL488-21525 targets ITK in applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16132 Product name: Recombinant human ITK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-258 aa of BC109077 Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK Predict reactive species |
| Full Name | IL2-inducible T-cell kinase |
| Calculated Molecular Weight | 620 aa, 72 kDa |
| GenBank Accession Number | BC109077 |
| Gene Symbol | ITK |
| Gene ID (NCBI) | 3702 |
| RRID | AB_2919181 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08881 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
