IFN-beta Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IFN-beta Polyclonal antibody (27506-1-AP)

IFN-beta Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27506-1-AP Copied!

Publications (38)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

IFN beta, IFNB1, IFN β1, IFNB, IFN-β1

• 

  WB analysis of Recombinant protein using 27506-1-AP

  Recombinant protein were subjected to SDS PAGE followed by western blot with 27506-1-AP (IFN Beta antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27506-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using IFN-beta antibody (27506-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of L02 using 27506-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed L02 cells using IFN-beta antibody (27506-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27506-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 27506-1-AP (IFN-beta antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IFN-beta in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Recombinant protein
• Positive IF/ICC detected in: HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27506-1-AP targets IFN-beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26326

  Product name: Recombinant human IFNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-187 aa of BC069314

  Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

• Full Name: IFN beta
• Calculated Molecular Weight: 187 aa, 22 kDa
• GenBank Accession Number: BC069314
• Gene Symbol: IFN beta1
• Gene ID (NCBI): 3456
• RRID: AB_2880893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01574
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interferon-beta (IFN-β) is a type I interferon, which is a group of signaling proteins made and released by host cells in response to the presence of several viruses, including double-stranded RNA produced by many viruses. IFN-β is a single protein species and is molecularly related to IFN-α subtypes, although it is antigenically distinct from them. It is mainly produced by fibroblasts and plays a crucial role in the innate immune response against viruses. IFN-β can inhibit viral replication by interfering with the virus's RNA or DNA, thus suppressing viral growth. It also enhances the cytotoxic activity of natural killer (NK) cells and promotes the expression of major histocompatibility complex (MHC) class I molecules.

Publications

What published studies show

Anti-IFN-β (catalog no. 27506-1-AP) has accumulated 38 citations. Publications appear in journals including Nature Communications, Molecular Cell, Cancer Research, Advanced Science, Biomaterials, Cell Reports, FASEB Journal, Free Radical Biology & Medicine, Acta Pharmaceutica Sinica B, Cell Death & Disease, and others. Associated research fields encompass cancer immunotherapy, innate immunity, cGAS-STING signaling, type I interferon responses, antiviral defense, and inflammatory/autoimmune diseases.

Automatically generated from the 38 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; GFER Represents a Target for Dual Disruption of Redox Homeostasis and Reactivation of the Immune Response in Pancreatic Adenocarcinoma.; Authors - Ziheng Chen
human	IF	Nat Commun; Airway immune profiles and therapeutic implications of IGF1 in eosinophilic granulomatosis with polyangiitis.; Authors - Cong Dong
human	WB	Int J Oral Sci; Targeting IFN-I driven tertiary lymphoid structures halts B cell-mediated bone loss in periodontitis.; Authors - Jiawei Lu
		Mol Cell; hnRNPM protects against the dsRNA-mediated interferon response by repressing LINE-associated cryptic splicing; Authors - Rong Zheng
human	WB	Acta Pharm Sin B; A new approach to discovering a broad-spectrum anti-respiratory virus drug: Tubeimoside II modulates host factor PACT to potentiate the RIG-I antiviral pathway.; Authors - Xian Liu ; KO Validated
human	IHC	Adv Sci (Weinh); Inhibition of CDH11 Activates cGAS-STING by Stimulating Branched Chain Amino Acid Catabolism and Mitigates Lung Metastasis of Adenoid Cystic Carcinoma; Authors - Rui-Feng Li