KDM4A Polyclonal antibody

KDM4A Polyclonal Antibody for WB, FC (Intra), IP, ELISA

Cat No. 29977-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, CoIP, ELISA

JMJD2, JmjC domain-containing histone demethylation protein 3A, JHDM3A, EC:1.14.11.66, [histone H3]-trimethyl-L-lysine(9) demethylase 4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse lung tissue, MCF-7 cells, MDA-MB-231 cells, NCl-H1299 cells
Positive IP detected inMCF-7 cells, A549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29977-1-AP targets KDM4A in WB, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31992

Product name: Recombinant human KDM4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 584-720 aa of BC002558

Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

Predict reactive species
Full Name lysine (K)-specific demethylase 4A
Calculated Molecular Weight 1064 aa, 121 kDa
Observed Molecular Weight130-150 kDa
GenBank Accession NumberBC002558
Gene Symbol KDM4A
Gene ID (NCBI) 9682
RRIDAB_2923625
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75164
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.

Protocols

Product Specific Protocols
FC protocol for KDM4A antibody 29977-1-APDownload protocol
IP protocol for KDM4A antibody 29977-1-APDownload protocol
WB protocol for KDM4A antibody 29977-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Commun Signal

HPV11 targeting KDM4A regulates the polarization of macrophage M1 and promotes the development of nasal inverted papilloma

Authors - Liying Zheng
  • KO Validated

Biochem Pharmacol

SD49-7 attenuates cardiac hypertrophy by upregulation of S100B through KDM4A inhibition

Authors - Zhenzhen Zhang
humanWB

Adv Sci (Weinh)

Targeting Intratumoral Copper Inhibits Tumor Progression via p62-Mediated EZH2 Degradation and Potentiates Anti-PD-1 Immunotherapy in Oral Squamous Cell Carcinoma

Authors - Xiaohu Lin
humanCoIP

J Environ Sci (China)

Carbon black induced pulmonary fibrosis through piR-713551/PIWIL4 targeting THBS2 signal pathway

Authors - Mengruo Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zhongli (Verified Customer) (03-14-2026)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
Loading...
||
New chat

Able

正在加载,请稍候...