CoraLite® Plus 488-conjugated KDM4A Polyclonal antibody

KDM4A Polyclonal Antibody for FC (Intra)
Cat No. CL488-29977

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

FC (Intra)

JHDM3A, JMJD2, JMJD2A, KDM4A, KIAA0677, lysine (K) demethylase 4A, Lysine specific demethylase 4A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA549 cells
Positive FC detected inA549 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29977 targets KDM4A in FC (Intra) applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31992

Product name: Recombinant human KDM4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 584-720 aa of BC002558

Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

Predict reactive species
Full Name lysine (K)-specific demethylase 4A
Calculated Molecular Weight 1064 aa, 121 kDa
Observed Molecular Weight130-150 kDa
GenBank Accession NumberBC002558
Gene Symbol KDM4A
Gene ID (NCBI) 9682
RRIDAB_3672841
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75164
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 KDM4A antibody CL488-29977Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...