CoraLite® Plus 488-conjugated KDM4A Polyclonal antibody

• 

  FC experiment of A549 using CL488-29977

  1x10^6 A549 cells were intracellularly stained with 0.8 ug Coralite® Plus 488 Kdm4a Polyclonal Antibody (CL488-29977)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

KDM4A Polyclonal Antibody for FC (Intra)

Cat No. CL488-29977

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

FC (Intra)

Synonyms

JHDM3A, JMJD2, JMJD2A, KDM4A, KIAA0677, lysine (K) demethylase 4A, Lysine specific demethylase 4A

---

Tested Applications

• Positive FC (Intra) detected in: A549 cells
• Positive FC detected in: A549 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29977 targets KDM4A in FC (Intra) applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31992

  Product name: Recombinant human KDM4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 584-720 aa of BC002558

  Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

• Full Name: lysine (K)-specific demethylase 4A
• Calculated Molecular Weight: 1064 aa, 121 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC002558
• Gene Symbol: KDM4A
• Gene ID (NCBI): 9682
• RRID: AB_3672841
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75164
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.