Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-82931 targets KHSRP in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33890 Product name: Recombinant human KHSRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 600-710 aa of NM_003685 Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Predict reactive species |
| Full Name | KH-type splicing regulatory protein |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | NM_003685 |
| Gene Symbol | KHSRP |
| Gene ID (NCBI) | 8570 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92945 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 KHSRP antibody CL488-82931 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

