Tested Applications
| Positive WB detected in | HeLa cells, HEK-293T cells, Jurkat cells, mouse spleen tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
82931-1-RR targets KHSRP in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33890 Product name: Recombinant human KHSRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 600-710 aa of NM_003685 Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Predict reactive species |
| Full Name | KH-type splicing regulatory protein |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | NM_003685 |
| Gene Symbol | KHSRP |
| Gene ID (NCBI) | 8570 |
| RRID | AB_3670669 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92945 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for KHSRP antibody 82931-1-RR | Download protocol |
| IF protocol for KHSRP antibody 82931-1-RR | Download protocol |
| IHC protocol for KHSRP antibody 82931-1-RR | Download protocol |
| IP protocol for KHSRP antibody 82931-1-RR | Download protocol |
| WB protocol for KHSRP antibody 82931-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













