Ki-67 Monoclonal antibody, PBS Only (Detector)

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 66555-6-PBS
Clone No.1B9H2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

KI67, MKI67, 1B9H2, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66555-6-PBS targets Ki-67 as part of a matched antibody pair:

MP50237-3: 66555-5-PBS capture and 66555-6-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26266

Product name: Recombinant human KI67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1201-1300 aa of NM_002417

Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight 359 kDa
GenBank Accession NumberNM_002417
Gene Symbol KI67
Gene ID (NCBI) 4288
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46013
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Loading...
||
New chat

Able

正在加载,请稍候...