Tested Applications
| Positive WB detected in | rat brain tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67009-1-Ig targets KIF5A in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.
| Tested Reactivity | Human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15682 Product name: Recombinant human KIF5A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species |
| Full Name | kinesin family member 5A |
| Calculated Molecular Weight | 1032 aa, 117 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC146670 |
| Gene Symbol | KIF5A |
| Gene ID (NCBI) | 3798 |
| RRID | AB_2882326 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q12840 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF5A antibody 67009-1-Ig | Download protocol |
| WB protocol for KIF5A antibody 67009-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





