CoraLite® Plus 488-conjugated KIF5A Monoclonal antibody

KIF5A Monoclonal Antibody for IF/ICC
Cat No. CL488-67009
Clone No.1A7E3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

IF/ICC

D12S1889, KIF5A, kinesin family member 5A, Kinesin heavy chain isoform 5A, MY050, Neuronal kinesin heavy chain, NKHC, NKHC1, SPG10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67009 targets KIF5A in IF/ICC applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15682

Product name: Recombinant human KIF5A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 931-1032 aa of BC146670

Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Predict reactive species
Full Name kinesin family member 5A
Calculated Molecular Weight 1032 aa, 117 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC146670
Gene Symbol KIF5A
Gene ID (NCBI) 3798
RRIDAB_3084298
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ12840
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KIF5A antibody CL488-67009Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...