KIF5A Recombinant monoclonal antibody

KIF5A Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 84013-5-RR
Clone No.241124H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

241124H5, D12S1889, Kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, MY050

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, U-87-MG cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inK562, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84013-5-RR targets KIF5A in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15518

Product name: Recombinant human KIF5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 931-1032 aa of BC146670

Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Predict reactive species
Full Name kinesin family member 5A
Calculated Molecular Weight 1032 aa, 117 kDa
Observed Molecular Weight 118-120 kDa
GenBank Accession NumberBC146670
Gene Symbol KIF5A
Gene ID (NCBI) 3798
RRIDAB_3671582
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ12840
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.

Protocols

Product Specific Protocols
FC protocol for KIF5A antibody 84013-5-RRDownload protocol
IHC protocol for KIF5A antibody 84013-5-RRDownload protocol
WB protocol for KIF5A antibody 84013-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...