Tested Applications
| Positive IF-P detected in | mouse kidney tissue | 
| Positive FC (Intra) detected in | ACHN cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67331 targets KL in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag27838 Product name: Recombinant human KL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 34-184 aa of NM_004795 Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG Predict reactive species | 
                                    
| Full Name | klotho | 
| Calculated Molecular Weight | 116 kDa | 
| Observed Molecular Weight | 125-135 kDa | 
| GenBank Accession Number | NM_004795 | 
| Gene Symbol | KL | 
| Gene ID (NCBI) | 9365 | 
| RRID | AB_3672943 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | Q9UEF7 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 KL antibody CL488-67331 | Download protocol | 
| IF protocol for CL Plus 488 KL antibody CL488-67331 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



