Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67892 targets KPNA3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27767 Product name: Recombinant human KPNA3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species |
| Full Name | karyopherin alpha 3 (importin alpha 4) |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC017355 |
| Gene Symbol | KPNA3 |
| Gene ID (NCBI) | 3839 |
| RRID | AB_2934583 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00505 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
karyopherin subunit alpha 3 (KPNA3) is a member of the importin alpha family which can transport molecules between the mucleus and cytoplasm. It is ubiquitous expressed in brain,testis and esophagus. KPNA3 is associated with many severe diseases such as hepatocellular Carcinoma (PMID: 31417635) , schizophrenia, major depression and opiate dependence (PMID: 22960338) . The molecular weight of KPNA3 is about 58 kDa.

