Tested Applications
| Positive WB detected in | A431 cells, rat skin tissue |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human cervical cancer tissue, mouse skin tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HaCaT cells, HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10143-1-AP targets Cytokeratin 14 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0188 Product name: Recombinant human KRT14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 262-472 aa of BC002690 Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species |
| Full Name | keratin 14 |
| Calculated Molecular Weight | 472 aa, 52 kDa |
| Observed Molecular Weight | 47-50 kDa |
| GenBank Accession Number | BC002690 |
| Gene Symbol | Cytokeratin 14 |
| Gene ID (NCBI) | 3861 |
| RRID | AB_2134831 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02533 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cytokeratin 14 antibody 10143-1-AP | Download protocol |
| IF protocol for Cytokeratin 14 antibody 10143-1-AP | Download protocol |
| IHC protocol for Cytokeratin 14 antibody 10143-1-AP | Download protocol |
| IP protocol for Cytokeratin 14 antibody 10143-1-AP | Download protocol |
| WB protocol for Cytokeratin 14 antibody 10143-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cytokeratin 14 (KRT14) polyclonal antibody (Cat# 10143-1-AP) has accumulated 132 citations published in over 80 journals, including Nature Communications, Cell Stem Cell, Biomaterials, Acta Biomaterialia, Oncogene, Cell Reports, and Journal of Investigative Dermatology. Key research fields include wound healing, epidermal and keratinocyte biology, psoriasis, olfactory epithelium regeneration, corneal homeostasis, cancer biology, tissue engineering, hair follicle stem cells, and diabetic skin repair.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Peptide RL-QN15 Regulates Functions of Epidermal Stem Cells to Accelerate Skin Wound Regeneration via the FZD8/β-Catenin Axis. | ||
Bioact Mater Biomimetic gender-specific human skin model based on gonads/epidermis-on-a-chip | ||
Cell Stem Cell Injury Induces Endogenous Reprogramming and Dedifferentiation of Neuronal Progenitors to Multipotency. | ||
Nat Commun Malfunction of airway basal stem cells plays a crucial role in pathophysiology of tracheobronchopathia osteoplastica. | ||
Nat Commun Human induced pluripotent stem cell-derived vocal fold mucosa mimics development and responses to smoke exposure. |
Reviews
What customers say
All four reviewers rated the antibody 4–5 stars. Users report bright, specific staining across multiple applications including immunohistochemistry (lung cancer tissue at 1:100), immunofluorescence (prostate basal cells at 1:400, human keratinocytes at 1:500), and Western blot (MCF10A cells at 1:200). One reviewer noted it performed well with pH9 TE buffer for IHC-DAB. Overall, customers describe it as an excellent, reliable antibody and express intent to repurchase for future experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nikolett (Verified Customer) (03-31-2026) | This antibody is ideal to human lung cancer tissue as a 1:100 dilution, utilized for IHC DAB staining with pH9 TE buffer.
|
Rachel (Verified Customer) (03-19-2024) | Excellent antibody, got the tester but will be purchasing more for future work.
 |
Parmveer (Verified Customer) (10-20-2019) | Worked well to detect basal cells around the prostate gland of formalin fixed tissue
 |
Joshua (Verified Customer) (05-10-2019) | Human Keratinocytes fixed in 4% paraformaldehyde and stained for KRT14. Goat anti-rabbit 488. Bright, specific staining observed.
 |
