• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Cytokeratin 14 Polyclonal antibody

Cytokeratin 14 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-10143

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Cell and organelle markers, CK 14, CK14, Cytokeratin 14, Cytoskeleton Marker, EBS3, EBS4, K14, keratin 14, KRT14, NFJ

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, HaCaT cells
Positive FC (Intra) detected inA431 cells
Positive FC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-10143 targets Cytokeratin 14 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0188

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-472 aa of BC002690

Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_2919721
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Protocols

Product Specific Protocols
IF protocol for CL594 Cytokeratin 14 antibody CL594-10143Download protocol
FC protocol for CL594 Cytokeratin 14 antibody CL594-10143Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...