LDHB Recombinant monoclonal antibody

LDHB Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), IP, ELISA
Cat No. 81963-1-RR
Clone No.1M20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

lactate dehydrogenase B, 1M20, EC:1.1.1.27, LDH, LDH B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, DU 145 cells, rat heart tissue, mouse brain tissue, rat brain tissue
Positive IP detected inHeLa cells
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81963-1-RR targets LDHB in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6605

Product name: Recombinant human LDHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-334 aa of BC002362

Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Predict reactive species
Full Name lactate dehydrogenase B
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002362
Gene Symbol LDHB
Gene ID (NCBI) 3945
RRIDAB_2935594
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07195
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)

Protocols

Product Specific Protocols
FC protocol for LDHB antibody 81963-1-RRDownload protocol
IF protocol for LDHB antibody 81963-1-RRDownload protocol
IP protocol for LDHB antibody 81963-1-RRDownload protocol
WB protocol for LDHB antibody 81963-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...