Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, DU 145 cells, rat heart tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81963-1-RR targets LDHB in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL Predict reactive species |
| Full Name | lactate dehydrogenase B |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC002362 |
| Gene Symbol | LDHB |
| Gene ID (NCBI) | 3945 |
| RRID | AB_2935594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07195 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDHB antibody 81963-1-RR | Download protocol |
| IP protocol for LDHB antibody 81963-1-RR | Download protocol |
| WB protocol for LDHB antibody 81963-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







