LDHB Recombinant monoclonal antibody, PBS Only

LDHB Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 81963-1-PBS
Clone No.1M20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

lactate dehydrogenase B, EC:1.1.1.27, LDH, LDH B, LDH H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81963-1-PBS targets LDHB in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6605

Product name: Recombinant human LDHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-334 aa of BC002362

Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Predict reactive species
Full Name lactate dehydrogenase B
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002362
Gene Symbol LDHB
Gene ID (NCBI) 3945
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07195
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)

Loading...
||
New chat

Able

正在加载,请稍候...