LRRC32 Recombinant monoclonal antibody, PBS Only (Capture)

LRRC32 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86059-2-PBS
Clone No.250611B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

Garpin, D11S833E, GARP, Leucine-rich repeat-containing protein 32, Transforming growth factor beta activator LRRC32

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86059-2-PBS targets LRRC32 as part of a matched antibody pair:

MP02335-1: 86059-2-PBS capture and 86059-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag23423

Product name: Recombinant human LRRC32 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 477-662 aa of BC070079

Sequence: PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA

Predict reactive species
Full Name leucine rich repeat containing 32
Calculated Molecular Weight 72 kDa
Observed Molecular Weight72-80 kDa
GenBank Accession NumberBC070079
Gene Symbol LRRC32
Gene ID (NCBI) 2615
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14392
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LRRC32, also known as GARP, is a transmembrane protein of 662 amino acids, the extracellular portion of which contains 20 leucine-rich repeats (PMID: 8180135). LRRC32 is a cell surface receptor on regulatory T-lymphocytes (Treg cells), platelets, hepatic stellate cells and certain cancer cells (PMID: 27054568). It has been demonstrated as a Treg-specific activation marker (PMID: 20137067). LRRC32 is critical for the surface expression of latent TGF-β by binding to the complex and functioning as its cell surface receptor (PMID: 19651619).

Loading...
||
New chat

Able

正在加载,请稍候...