Product Information
84398-3-PBS targets MACROD1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34080 Product name: Recombinant human MACROD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-166 aa of BC008316 Sequence: AMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV Predict reactive species |
| Full Name | MACRO domain containing 1 |
| Calculated Molecular Weight | 325 aa, 36 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC008316 |
| Gene Symbol | MACROD1 |
| Gene ID (NCBI) | 28992 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9BQ69 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MACRO domain containing 1 (Macrod1) is also named as LRP16. Macrod1 is an ADP-ribosylhydrolase 1 that is highly enriched in mitochondria, participating in the pathogenesis of cardiovascular diseases (PMID: 38459256). MacroD1 was recruited to the sites of DNA damage via recognition of ADP-ribosylation at DNA lesions (PMID: 32683309). MacroD1 is highly expressed in human and mouse skeletal muscle (PMID: 29410655). Macrod1 may play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PMID: 17893710, PMID: 17914104). Macrod1 could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PMID: 17893710).



