MACROD1 Recombinant monoclonal antibody

• 

  WB analysis using 84398-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84398-3-RR (MACROD1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 84398-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84398-3-RR against Human MACROD1 were performed. The affinity constant is 11.1 nM.

MACROD1 Recombinant Antibody for WB, ELISA

Cat No. 84398-3-RR

Clone No.241506C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:3.2.2.-, EC:3.1.1.106, ADP-ribose glycohydrolase MACROD1, 241506C1, [Protein ADP-ribosylglutamate] hydrolase MACROD1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84398-3-RR targets MACROD1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34080

  Product name: Recombinant human MACROD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 82-166 aa of BC008316

  Sequence: AMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV

• Full Name: MACRO domain containing 1
• Calculated Molecular Weight: 325 aa, 36 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC008316
• Gene Symbol: MACROD1
• Gene ID (NCBI): 28992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BQ69
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MACRO domain containing 1 (Macrod1) is also named as LRP16. Macrod1 is an ADP-ribosylhydrolase 1 that is highly enriched in mitochondria, participating in the pathogenesis of cardiovascular diseases (PMID: 38459256). MacroD1 was recruited to the sites of DNA damage via recognition of ADP-ribosylation at DNA lesions (PMID: 32683309). MacroD1 is highly expressed in human and mouse skeletal muscle (PMID: 29410655). Macrod1 may play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PMID: 17893710, PMID: 17914104). Macrod1 could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PMID: 17893710).