• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated MDH1 Monoclonal antibody

MDH1 Monoclonal Antibody for IF/ICC
Cat No. CL594-66505
Clone No.1F9A2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

IF/ICC

Cytosolic malate dehydrogenase, MDH s, MDH1, MDHA, MOR2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66505 targets MDH1 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8744

Product name: Recombinant human MDH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-334 aa of BC001484

Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Predict reactive species
Full Name malate dehydrogenase 1, NAD (soluble)
Calculated Molecular Weight 334 aa, 36 kDa
Observed Molecular Weight 36-37 kDa
GenBank Accession NumberBC001484
Gene Symbol MDH1
Gene ID (NCBI) 4190
RRIDAB_2934728
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40925
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme. (PMID:10693743)

Protocols

Product Specific Protocols
IF protocol for CL594 MDH1 antibody CL594-66505Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...