MDH1 Monoclonal antibody

• 

  WB analysis using 66505-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66505-1-Ig

  WB result of MDH1 antibody (66505-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MDH1 transfected HEK-293 cells.

• 

  WB analysis of NIH/3T3 using 66505-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66505-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat heart using 66505-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66505-1-Ig (MDH1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 66505-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66505-1-Ig (MDH1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66505-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 66505-1-Ig (MDH1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HEK-293 using 66505-1-Ig

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human MDH1 (66505-1-Ig, Clone:1F9A2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

MDH1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66505-1-Ig

Clone No.1F9A2

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

MDHA, KAR, EC:1.1.1.96, EC:1.1.1.37, Aromatic alpha-keto acid reductase

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, NIH/3T3 cells, RAW 264.7 cells, Jurkat cells
• Positive IHC detected in: rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

66505-1-Ig targets MDH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8744

  Product name: Recombinant human MDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001484

  Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

• Full Name: malate dehydrogenase 1, NAD (soluble)
• Calculated Molecular Weight: 334 aa, 36 kDa
• Observed Molecular Weight: 36-37 kDa
• GenBank Accession Number: BC001484
• Gene Symbol: MDH1
• Gene ID (NCBI): 4190
• RRID: AB_2881868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P40925
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme. (PMID:10693743)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Cell Mol Biol Lett; IDH1/MDH1 deacetylation promotes acute liver failure by regulating NETosis; Authors - Yukun Wang
mouse	WB	J Proteome Res; Characteristics of Myocardial Structure and Central Carbon Metabolism during the Early and Compensatory Stages of Cardiac Hypertrophy; Authors - Yuan Chen