MIOS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83856-5-RR (same clone as 83856-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83856-5-RR (MIOS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83856-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83856-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83856-5-RR against Human MIOS were performed. The affinity constant is below 1 pM.

MIOS Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83856-5-PBS

Clone No.240832B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Missing oocyte meiosis regulator homolog, GATOR2 complex protein MIOS, 240832B9

---

Product Information

83856-5-PBS targets MIOS in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15148

  Product name: Recombinant human MIOS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 188-537 aa of BC005883

  Sequence: AVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP

• Full Name: missing oocyte, meiosis regulator, homolog (Drosophila)
• Calculated Molecular Weight: 875 aa, 99 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC005883
• Gene Symbol: MIOS
• Gene ID (NCBI): 54468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NXC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mechanistic target of rapamycin complex 1 (mTORC1) controls growth by regulating anabolic and catabolic processes in response to environmental cues, including nutrients. Amino acids signal to mTORC1 through the Rag GTPases, which are regulated by several protein complexes, including GATOR1 and GATOR2. GATOR2, which has five components (WDR24, MIOS, WDR59, SEH1L, SEC13), is required for amino acids to activate mTORC1. PMID: 35831510