Tested Applications
| Positive WB detected in | HL-60 cells, U-937 cells |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human colon cancer tissue, human liver tissue, human spleen tissue, rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 54 publications below |
| IHC | See 101 publications below |
| IF | See 75 publications below |
| ELISA | See 5 publications below |
Product Information
22225-1-AP targets MPO in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
| Full Name | myeloperoxidase |
| Calculated Molecular Weight | 745 aa, 84 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC130476 |
| Gene Symbol | MPO |
| Gene ID (NCBI) | 4353 |
| RRID | AB_2879037 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MPO antibody 22225-1-AP | Download protocol |
| IHC protocol for MPO antibody 22225-1-AP | Download protocol |
| IP protocol for MPO antibody 22225-1-AP | Download protocol |
| WB protocol for MPO antibody 22225-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Crit Care Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein. | ||
Blood C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse | ||
Acta Pharm Sin B A new perspective of triptolide-associated hepatotoxicity: the relevance of NF- κ B and NF- κ B-mediated cellular FLICE-inhibitory protein. | ||
Acta Pharm Sin B A non-human primate derived anti-P-selectin glycoprotein ligand-1 antibody curtails acute pancreatitis by alleviating the inflammatory responses | ||
Sci Adv Astrocytic NDRG2-PPM1A interaction exacerbates blood-brain barrier disruption after subarachnoid hemorrhage | ||
Acta Biomater An electrospun scaffold functionalized with a ROS-scavenging hydrogel stimulates ocular wound healing |

























