MPO Polyclonal antibody

• 

  WB analysis of HL-60 using 22225-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 22225-1-AP (MPO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 22225-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 22225-1-AP (MPO antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 22225-1-AP

  IP result of anti-MPO (IP:22225-1-AP, 4ug; Detection:22225-1-AP 1:4000) with HL-60 cells lysate 1720 ug.

• 

  IHC staining of human colon cancer using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat spleen using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 22225-1-AP (MPO antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 22225-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 22225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 22225-1-AP (MPO antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human tonsillitis using 22225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using MPO antibody (22225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse ovary using 22225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse ovary tissue using MPO antibody (22225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 22225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 22225-1-AP (MPO antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

MPO Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22225-1-AP

Publications(203)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

EC:1.11.2.2, myeloperoxidase

---

Tested Applications

• Positive WB detected in: HL-60 cells, U-937 cells
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human colon cancer tissue, human liver tissue, human spleen tissue, rat spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue, mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 51 publications below
• IHC: See 98 publications below
• IF: See 70 publications below
• ELISA: See 5 publications below

Product Information

22225-1-AP targets MPO in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17564

  Product name: Recombinant human MPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-657 aa of BC130476

  Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

• Full Name: myeloperoxidase
• Calculated Molecular Weight: 745 aa, 84 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC130476
• Gene Symbol: MPO
• Gene ID (NCBI): 4353
• RRID: AB_2879037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05164
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Crit Care; Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein.; Authors - Lingbing Zhang
human	IHC	Blood; C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse; Authors - Li-Xue Yang
mouse	WB,IHC	Acta Pharm Sin B; A new perspective of triptolide-associated hepatotoxicity: the relevance of NF- κ B and NF- κ B-mediated cellular FLICE-inhibitory protein.; Authors - Ziqiao Yuan
mouse	IHC,IF	Acta Pharm Sin B; A non-human primate derived anti-P-selectin glycoprotein ligand-1 antibody curtails acute pancreatitis by alleviating the inflammatory responses; Authors - Yuhan Li
mouse	IF	Sci Adv; Astrocytic NDRG2-PPM1A interaction exacerbates blood-brain barrier disruption after subarachnoid hemorrhage; Authors - Dayun Feng
rat	IHC	Acta Biomater; An electrospun scaffold functionalized with a ROS-scavenging hydrogel stimulates ocular wound healing; Authors - Xin Shi