MPO Polyclonal antibody, PBS Only

• 

  WB analysis of HL-60 using 22225-1-AP (same clone as 22225-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 22225-1-AP (MPO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 22225-1-AP (same clone as 22225-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 22225-1-AP (MPO antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 22225-1-AP (same clone as 22225-1-PBS)

  IP result of anti-MPO (IP:22225-1-AP, 4ug; Detection:22225-1-AP 1:4000) with HL-60 cells lysate 1720 ug. This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22225-1-AP (MPO antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22225-1-AP (same clone as 22225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 22225-1-AP (MPO antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 22225-1-AP (same clone as 22225-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 22225-1-AP (MPO antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 22225-1-AP (same clone as 22225-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using MPO antibody (22225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse ovary using 22225-1-AP (same clone as 22225-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse ovary tissue using MPO antibody (22225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 22225-1-AP (same clone as 22225-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 22225-1-AP (MPO antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22225-1-PBS in a different storage buffer formulation.

MPO Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 22225-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

EC:1.11.2.2, myeloperoxidase

---

Product Information

22225-1-PBS targets MPO in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17564

  Product name: Recombinant human MPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-657 aa of BC130476

  Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

• Full Name: myeloperoxidase
• Calculated Molecular Weight: 745 aa, 84 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC130476
• Gene Symbol: MPO
• Gene ID (NCBI): 4353
• RRID: AB_2879037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO.