Biotin-conjugated MPO Polyclonal antibody

MPO Polyclonal Antibody for IF-P, ELISA

Cat No. Biotin-22225

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, ELISA

EC:1.11.2.2, myeloperoxidase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-22225 targets MPO in IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17564

Product name: Recombinant human MPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-657 aa of BC130476

Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

Predict reactive species
Full Name myeloperoxidase
Calculated Molecular Weight 745 aa, 84 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC130476
Gene Symbol MPO
Gene ID (NCBI) 4353
Conjugate Biotin
Excitation/Emission Maxima Wavelengths-
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05164
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO.

Protocols

Product Specific Protocols
IF protocol for Biotin MPO antibody Biotin-22225Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...