Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-13508 targets MTPN in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4419 Product name: Recombinant human MTPN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC028093 Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ Predict reactive species |
| Full Name | myotrophin |
| Calculated Molecular Weight | 118 aa, 13 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC028093 |
| Gene Symbol | MTPN |
| Gene ID (NCBI) | 136319 |
| RRID | AB_3672569 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58546 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Myotrophin (MTPN) is a ubiquitously expressed 12 kDa cytoplamic protein that was first isolated from the hearts of spontaneously hypertensive rats. Protein sequence analysis revealed that MTPN was composed of 118 amino acids and was occupied by two and a half internal 33 amino acid ankyrin repeats. MTPN stimulates protein synthesis and increases the expression of a number of cardiac marker genes (such as atrial natriuretic factor and b-myosin heavy chain) in cardiomyocytes leading to hypertrophy. In skeletal muscle, MTPN is also a positive growth factor in promoting skeletal muscle growth.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 MTPN antibody CL488-13508 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

