CoraLite® Plus 488-conjugated MTPN Polyclonal antibody

MTPN Polyclonal Antibody for IF/ICC
Cat No. CL488-13508

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

FLJ31098, FLJ99857, GCDP, MTPN, myotrophin, Protein V 1, V 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13508 targets MTPN in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4419

Product name: Recombinant human MTPN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-118 aa of BC028093

Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Predict reactive species
Full Name myotrophin
Calculated Molecular Weight 118 aa, 13 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC028093
Gene Symbol MTPN
Gene ID (NCBI) 136319
RRIDAB_3672569
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP58546
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Myotrophin (MTPN) is a ubiquitously expressed 12 kDa cytoplamic protein that was first isolated from the hearts of spontaneously hypertensive rats. Protein sequence analysis revealed that MTPN was composed of 118 amino acids and was occupied by two and a half internal 33 amino acid ankyrin repeats. MTPN stimulates protein synthesis and increases the expression of a number of cardiac marker genes (such as atrial natriuretic factor and b-myosin heavy chain) in cardiomyocytes leading to hypertrophy. In skeletal muscle, MTPN is also a positive growth factor in promoting skeletal muscle growth.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MTPN antibody CL488-13508Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...