Myosin Light Chain 2/MLC-2V Polyclonal antibody

Myosin Light Chain 2/MLC-2V Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

Cat No. 10906-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish and More (2)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

MLC 2v, MYL2, MLC 2, MLC2, MLC-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inmouse heart tissue, human heart tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF-Fro detected inmouse heart tissue
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10906-1-AP targets Myosin Light Chain 2/MLC-2V in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, pig, monkey, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1356

Product name: Recombinant human MYL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC015821

Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predict reactive species
Full Name myosin, light chain 2, regulatory, cardiac, slow
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC015821
Gene Symbol Myosin Light Chain 2
Gene ID (NCBI) 4633
RRIDAB_2147453
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10916
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

MYL2 belongs to the myosin family of motor proteins. Their common features are ATP hydrolysis, actin binding, and potential for kinetic energy transduction. MYL2 stands for Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2), also known as the regulatory light chain of myosin (RLC). This isoform is distinct from those expressed in skeletal muscle (MYLPF), smooth muscle (MYL12B), and cardiac atrial muscle (MYL7) (PMID: 21345328). Due to its tissue specificity, MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.

 What is the molecular weight of MYL2?

There are two isoforms of this protein in humans that differ only slightly in length and produce proteins composed of 152 and 166 aa, which correspond to about 19 kDa (PMID: 16678204). 

 What is the subcellular localization of MYL2?

 It is uniquely expressed in the cytoplasm of heart muscles. It colocalizes with actin cytoskeleton staining.

 What is the tissue specificity of MYL2?

 MYL2 is specifically expressed in ventricular cardiac tissue.

 What is the function of MYL2 in cardiac tissue?

 MYL2 is a contractile protein that plays a role in heart development and function. During cardiogenesis it plays an early role in cardiac contractility by promoting cardiac myofibril assembly and represents one of the earliest markers of ventricular specification (PMID 8506363).

 In general, MYL2 interacts with the neck/tail region of the muscle thick filament protein myosin to regulate myosin motility and function (PMID 8316858). Its N-terminal domain is responsible for calcium and magnesium binding at their activating concentrations. This induces a functionally important conformational change (PMID: 18202317). However, the ion dissociation rate is not fast enough to modulate cardiac contractility on a beat-by-beat basis (PMIDs: 188447, 8804617). In addition, RLC function can be modulated by posttranslational modifications such as phosphorylation and deamidation in the N-terminal region. As a result, a significant change in the charge of the protein is introduced, which undoubtedly alters its interaction with the C-terminal myosin alpha-helical domain (PMID: 26074085).

 What is MYL2's involvement in disease?

 Diseases associated with MYL2 dysfunction include forms of familial hypertrophic cardiomyopathies, congenital fiber-type disproportion, and heart failure (PMID: 26074085). 


Protocols

Product Specific Protocols
FC protocol for Myosin Light Chain 2/MLC-2V antibody 10906-1-APDownload protocol
IF protocol for Myosin Light Chain 2/MLC-2V antibody 10906-1-APDownload protocol
IHC protocol for Myosin Light Chain 2/MLC-2V antibody 10906-1-APDownload protocol
IP protocol for Myosin Light Chain 2/MLC-2V antibody 10906-1-APDownload protocol
WB protocol for Myosin Light Chain 2/MLC-2V antibody 10906-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Science

Conversion of human fibroblasts into functional cardiomyocytes by small molecules.

Authors - Nan Cao
humanIF

Cell Stem Cell

Cardiac repair in a porcine model of acute myocardial infarction with human induced pluripotent stem cell-derived cardiovascular cells.

Authors - Lei Ye
human

Cell Stem Cell

Pathogenic LMNA variants disrupt cardiac lamina-chromatin interactions and de-repress alternative fate genes.

Authors - Parisha P Shah
pigIF

Cell Stem Cell

Gene editing to prevent ventricular arrhythmias associated with cardiomyocyte cell therapy

Authors - Silvia Marchiano
humanIF

Cell Stem Cell

Gene editing to prevent ventricular arrhythmias associated with cardiomyocyte cell therapy

Authors - Silvia Marchiano
human

Cell Stem Cell

Modeling the atrioventricular conduction axis using human pluripotent stem cell-derived cardiac assembloids

Authors - Jiuru Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (12-29-2023)

Worked well for WB at 1:1000 in Glioma cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glioblastoma
FH

Brice-Emmanuel (Verified Customer) (12-18-2023)

Works very well in WB, even after more than 10 days at room temperature due to a delivery problem.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/8000
  • Cell Tissue Type: Mouse Heart Tissue
Myosin Light Chain 2/MLC-2V Antibody Western Blot validation (1/8000 dilution) in Mouse Heart Tissue (Cat no:10906-1-AP)
FH

Rebecca (Verified Customer) (10-28-2022)

20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: iPSC-CM
Myosin Light Chain 2/MLC-2V Antibody Western Blot validation (1:1000 dilution) in iPSC-CM (Cat no:10906-1-AP)
FH

WEI (Verified Customer) (05-11-2022)

Strong, specific band for heart tissues

  • Applications: Western Blot
  • Cell Tissue Type: Mouse Heart
FH

Irem (Verified Customer) (04-19-2022)

This antibody unspecifically recognizes at least four proteins in Jurkat cell lysate. The specific band, around 17 kDa, is so faint.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: Jurkat cells
Myosin Light Chain 2/MLC-2V Antibody Western Blot validation (1:800 dilution) in Jurkat cells (Cat no:10906-1-AP)
FH

Ning (Verified Customer) (02-20-2022)

This antibody works very well in immunofluorescence staining for iPSC-derived ventricular cardiomyocytes.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: iPSC-derived cardiomyocytes
Myosin Light Chain 2/MLC-2V Antibody Immunofluorescence validation (1:500 dilution) in iPSC-derived cardiomyocytes (Cat no:10906-1-AP)
FH

Tongbin (Verified Customer) (08-25-2020)

This MLC2 antibody works very well in western blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Heart
Loading...
||
New chat

Able

正在加载,请稍候...