CoraLite® Plus 488-conjugated Myosin Light Chain 2/MLC-2V Polyclonal antibody

Myosin Light Chain 2/MLC-2V Polyclonal Antibody for IF-P

Cat No. CL488-10906

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

IF-P

CMH10, DKFZp779C0562, MLC 2, MLC 2v, MLC2, MLC2v, MYL2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-10906 targets Myosin Light Chain 2/MLC-2V in IF-P applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1356

Product name: Recombinant human MYL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC015821

Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predict reactive species
Full Name myosin, light chain 2, regulatory, cardiac, slow
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC015821
Gene Symbol Myosin Light Chain 2
Gene ID (NCBI) 4633
RRIDAB_2919010
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10916
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Background

MYL2 belongs to the myosin family of motor proteins. Their common features are ATP hydrolysis, actin binding, and potential for kinetic energy transduction. MYL2 stands for Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2), also known as the regulatory light chain of myosin (RLC). This isoform is distinct from those expressed in skeletal muscle (MYLPF), smooth muscle (MYL12B), and cardiac atrial muscle (MYL7) (PMID: 21345328). Due to its tissue specificity, MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.

 What is the molecular weight of MYL2?

There are two isoforms of this protein in humans that differ only slightly in length and produce proteins composed of 152 and 166 aa, which correspond to about 19 kDa (PMID: 16678204). 

 What is the subcellular localization of MYL2?

 It is uniquely expressed in the cytoplasm of heart muscles. It colocalizes with actin cytoskeleton staining.

 What is the tissue specificity of MYL2?

 MYL2 is specifically expressed in ventricular cardiac tissue.

 What is the function of MYL2 in cardiac tissue?

 MYL2 is a contractile protein that plays a role in heart development and function. During cardiogenesis it plays an early role in cardiac contractility by promoting cardiac myofibril assembly and represents one of the earliest markers of ventricular specification (PMID 8506363).

 In general, MYL2 interacts with the neck/tail region of the muscle thick filament protein myosin to regulate myosin motility and function (PMID 8316858). Its N-terminal domain is responsible for calcium and magnesium binding at their activating concentrations. This induces a functionally important conformational change (PMID: 18202317). However, the ion dissociation rate is not fast enough to modulate cardiac contractility on a beat-by-beat basis (PMIDs: 188447, 8804617). In addition, RLC function can be modulated by posttranslational modifications such as phosphorylation and deamidation in the N-terminal region. As a result, a significant change in the charge of the protein is introduced, which undoubtedly alters its interaction with the C-terminal myosin alpha-helical domain (PMID: 26074085).

 What is MYL2's involvement in disease?

 Diseases associated with MYL2 dysfunction include forms of familial hypertrophic cardiomyopathies, congenital fiber-type disproportion, and heart failure (PMID: 26074085). 


Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Myosin Light Chain 2/MLC-2V antibody CL488-10906Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Commun Signal

Downregulation of connexin 43-based gap junctions underlies propofol-induced excessive relaxation in hypertensive vascular smooth muscle cells

Authors - Weiqi Zeng
Loading...
||
New chat

Able

正在加载,请稍候...