Mammaglobin A Polyclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 23501-1-AP (same clone as 23501-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 23501-1-AP (Mammaglobin A antibody at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23501-1-AP (same clone as 23501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23501-1-AP (Mammaglobin A antibody at dilution of 1:50. This data was developed using the same antibody clone with 23501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23501-1-AP (same clone as 23501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23501-1-AP (Mammaglobin A antibody at dilution of 1:50. This data was developed using the same antibody clone with 23501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23501-1-AP (same clone as 23501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23501-1-AP (Mammaglobin A antibody at dilution of 1:50. This data was developed using the same antibody clone with 23501-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23501-1-AP (same clone as 23501-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23501-1-AP (Mammaglobin A antibody at dilution of 1:50. This data was developed using the same antibody clone with 23501-1-PBS in a different storage buffer formulation.

Mammaglobin A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23501-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

SCGB2A2, hMAM, Mammaglobin 1, Mammaglobin1, Mammaglobin-1

---

Product Information

23501-1-PBS targets Mammaglobin A in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20122

  Product name: Recombinant human SCGB2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-120 aa of BC067220

  Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG

• Full Name: secretoglobin, family 2A, member 2
• Calculated Molecular Weight: 120 aa, 13 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC067220
• Gene Symbol: Mammaglobin A
• Gene ID (NCBI): 4250
• RRID: AB_2879289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13296
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220).