Tested Applications
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23501-1-AP targets Mammaglobin A in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20122 Product name: Recombinant human SCGB2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC067220 Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG Predict reactive species |
| Full Name | secretoglobin, family 2A, member 2 |
| Calculated Molecular Weight | 120 aa, 13 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC067220 |
| Gene Symbol | Mammaglobin A |
| Gene ID (NCBI) | 4250 |
| RRID | AB_2879289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Mammaglobin A antibody 23501-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Mammaglobin A (SCGB2A2) polyclonal antibody (Cat# 23501-1-AP) has 2 total citations. These appear in Journal of Translational Medicine and Molecular Medicine Reports. Both studies focus on breast cancer research—one investigating tumor cell subsets as prognostic and therapeutic targets using WB, and the other examining MMP9/MMP2 immunolocalization in osteolytic metastasis from MDA-MB-231 breast cancer cells using IHC.
| Species | Application | Title |
|---|---|---|
J Transl Med Machine learning-based identification of kbhb-affected tumor cell subsets as prognostic and therapeutic targets in breast cancer. | ||
Mol Med Rep Immunolocalization of MMP9 and MMP2 in osteolytic metastasis originating from MDA-MB-231 human breast cancer cells. |
