Use Able AI chat for product recommendations

Midkine Recombinant monoclonal antibody, PBS Only

Midkine Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84815-1-PBS
Clone No.241880H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

MDK, 241880H1, Amphiregulin-associated protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84815-1-PBS targets Midkine in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24547

Product name: Recombinant human MDK protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-143 aa of BC011704

Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Predict reactive species
Full Name midkine (neurite growth-promoting factor 2)
Calculated Molecular Weight 16 kDa
GenBank Accession NumberBC011704
Gene Symbol Midkine
Gene ID (NCBI) 4192
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21741
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Midkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue.

Loading...
||
New chat

Able

正在加载,请稍候...