Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated NBR1 Monoclonal antibody

NBR1 Monoclonal Antibody for IF/ICC

Cat No. CL488-68062
Clone No.1F2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

1A1 3B, 1A13B, 1F2B2, Cell migration-inducing gene 19 protein, FLJ55359

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68062 targets NBR1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8652

Product name: Recombinant human NBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-353 aa of BC009808

Sequence: MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ

Predict reactive species
Full Name neighbor of BRCA1 gene 1
Calculated Molecular Weight 966 aa, 107 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC009808
Gene Symbol NBR1
Gene ID (NCBI) 4077
RRIDAB_2923876
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14596
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NBR1, also named as 1A13B, KIAA0049 and M17S2, acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets. NBR1 and P62 can bind to autophagic effector proteins (Atg8 in yeast, MAP1LC3 protein family in mammals) anchored in the membrane of autophagosomes. It is a highly conserved multidomain scaffold protein with proposed roles in endocytic trafficking and selective autophagy. NBR1 is a novel PB1 adapter in Th2 differentiation and asthma. It functions as an autophagy receptor involved in targeting ubiquitinated proteins for degradation. It also has a dual role as a scaffold protein to regulate growth-factor receptor and downstream signaling pathways. Observed MW of NBR1 is 140 kDa (PMID: 22654911, PMID: 22484440).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NBR1 antibody CL488-68062Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...