Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells, human liver tissue |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84498-1-RR targets NDUFA4L2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
| Calculated Molecular Weight | 87 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC011910 |
| Gene Symbol | NDUFA4L2 |
| Gene ID (NCBI) | 56901 |
| RRID | AB_3672011 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9NRX3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA4L2 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFA4L2 antibody 84498-1-RR | Download protocol |
| IHC protocol for NDUFA4L2 antibody 84498-1-RR | Download protocol |
| WB protocol for NDUFA4L2 antibody 84498-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











