NDUFA4L2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84498-1-RR (same clone as 84498-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84498-1-RR (NDUFA4L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 84498-1-RR (same clone as 84498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84498-1-RR (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 84498-1-RR (same clone as 84498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84498-1-RR (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84498-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84498-1-RR (same clone as 84498-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NDUFA4L2 antibody (84498-1-RR, Clone: 241622B12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84498-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84498-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84498-1-RR against Human NDUFA4L2 were performed. The affinity constant is below 1 pM.

NDUFA4L2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84498-1-PBS

Clone No.241622B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NUOMS, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2, 241622B12

---

Product Information

84498-1-PBS targets NDUFA4L2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9600

  Product name: Recombinant human NDUFA4L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC011910

  Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2
• Calculated Molecular Weight: 87 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC011910
• Gene Symbol: NDUFA4L2
• Gene ID (NCBI): 56901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NRX3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFA4L2 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.