Tested Applications
| Positive WB detected in | C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-83112 targets NEDD4 in WB applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16291 Product name: Recombinant human NEDD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 970-1319 aa of BC152452 Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 4 |
| Calculated Molecular Weight | 1319 aa, 149 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC152452 |
| Gene Symbol | NEDD4 |
| Gene ID (NCBI) | 4734 |
| RRID | AB_3673770 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P46934 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2. NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain. NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CL Plus 750 NEDD4 antibody CL750-83112 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

