Tested Applications
| Positive WB detected in | C6 cells, NIH/3T3 cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83112-1-RR targets NEDD4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16291 Product name: Recombinant human NEDD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 970-1319 aa of BC152452 Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 4 |
| Calculated Molecular Weight | 1319 aa, 149 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC152452 |
| Gene Symbol | NEDD4 |
| Gene ID (NCBI) | 4734 |
| RRID | AB_3097841 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P46934 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2. NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain. NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEDD4 antibody 83112-1-RR | Download protocol |
| IP protocol for NEDD4 antibody 83112-1-RR | Download protocol |
| WB protocol for NEDD4 antibody 83112-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







