Tested Applications
Positive WB detected in | HeLa cells, K-562 cells, PC-3 cells, HepG2 cells |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83986-5-RR targets NMI in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species |
Full Name | N-myc (and STAT) interactor |
Calculated Molecular Weight | 35 kDa |
Observed Molecular Weight | 37 kDa |
GenBank Accession Number | BC001268 |
Gene Symbol | NMI |
Gene ID (NCBI) | 9111 |
RRID | AB_3671561 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q13287 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NMI antibody 83986-5-RR | Download protocol |
IF protocol for NMI antibody 83986-5-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |