Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83986-5 targets NMI in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species |
| Full Name | N-myc (and STAT) interactor |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC001268 |
| Gene Symbol | NMI |
| Gene ID (NCBI) | 9111 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13287 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 NMI antibody CL488-83986-5 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

