Neuropeptide Y Polyclonal antibody

Neuropeptide Y Polyclonal Antibody for IHC, IF-P, IF-Fro, ELISA

Cat No. 12833-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, ELISA

NPY, C-flanking peptide of NPY, CPON, Neuropeptide tyrosine, Pro-neuropeptide Y

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman brain tissue, mouse brain tissue, human pancreas cancer tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue, mouse eye tissue
Positive IF-Fro detected inrat brain tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12833-1-AP targets Neuropeptide Y in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3568

Product name: Recombinant human NPY protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC029497

Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Predict reactive species
Full Name neuropeptide Y
Calculated Molecular Weight 97 aa, 11 kDa
GenBank Accession NumberBC029497
Gene Symbol Neuropeptide Y
Gene ID (NCBI) 4852
RRIDAB_10791890
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01303
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuropeptide Y (NPY) is one of the most abundant peptides in the mammalian central nervous system (CNS). NPY has been linked to several physiological and pathological functions, such as feeding behaviour, memory processing, pain, anxiety, cell proliferation and many other processes in the central and peripheral nervous systems. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. In addition, NPY was suggested as a potential neuroprotective agent in Alzheimer's disease by counteracting the toxic effect of β-amyloid in an in vitro model.

Protocols

Product Specific Protocols
IHC protocol for Neuropeptide Y antibody 12833-1-APDownload protocol
IF protocol for Neuropeptide Y antibody 12833-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseIHC,IF

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
ratIHC

ACS Appl Mater Interfaces

Lithium-Doped Titanium Dioxide-Based Multilayer Hierarchical Structure for Accelerating Nerve-Induced Bone Regeneration

Authors - Qianqian Zhang
mouseWB

Free Radic Biol Med

Inhibition of neuronal nitric oxide synthase protects against hippocampal neuronal injuries by increasing neuropeptide Y expression in temporal lobe epilepsy mice.

Authors - Yuanyuan Yao
humanIHC

J Orthop Translat

Suprascapular nerve injury affects rotator cuff healing: A paired controlled study in a rat model.

Authors - Yucheng Sun
ratIF

Front Behav Neurosci

Heterogeneous GAD65 Expression in Subtypes of GABAergic Neurons Across Layers of the Cerebral Cortex and Hippocampus.

Authors - Yuki Kajita

Acta Neurobiol Exp (Wars)

Aberrant changes of somatostatin and neuropeptide Y in brain of a genetic rat model for epilepsy: tremor rat.

Authors - Xiaoxue Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (04-12-2024)

NPY (green) worked nicely marking a subpopulation of interneurons in human brain FFPE cortex tissue.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
Neuropeptide Y Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:12833-1-AP)
Loading...